PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g018560.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GATA
Protein Properties Length: 257aa    MW: 29195.1 Da    PI: 7.5935
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g018560.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.7e-18172206135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Sopim10g018560.0.1 172 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 206
                         *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.4E-833254IPR016679Transcription factor, GATA, plant
SMARTSM004015.8E-14166216IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.451166202IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.95E-14169230No hitNo description
Gene3DG3DSA:3.30.50.101.0E-13170204IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.37E-13171218No hitNo description
PROSITE patternPS003440172197IPR000679Zinc finger, GATA-type
PfamPF003206.8E-16172206IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDVYGRLTPE VFRIDDFLDF SNEEDIFSSS KTAIDFDLNH HYQPPPTDSI ADTGCYYHAP  60
PNSVDFTDKL CVPSDDVAEL EWLSNFVEDS SNNFPSNNLT QTMYHLNNTN TILHSKSRSK  120
RSRNSNSTSW NTSSLQRHKS ANQKNSNQDE NSGDYNSNKL SNNSKIITSR KCTHCASEKT  180
PQWRTGPLGP KTLCNACGVR YKSGRLVPEY RPAASPTFVL TQHSNSHRKV MELRRQKEII  240
DQQQQHGMYG HHYPVC*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248553.10.0PREDICTED: GATA transcription factor 4-like
SwissprotO497415e-71GATA2_ARATH; GATA transcription factor 2
TrEMBLK4CYY00.0K4CYY0_SOLLC; Uncharacterized protein
STRINGSolyc10g018560.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-60GATA transcription factor 2